PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA05g13390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 285aa    MW: 32237.4 Da    PI: 4.2576
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA05g13390genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.11.5e-182274456
                -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                +++++ +q+++Le+ Fe ++++  e++ ++A++lgL+ rqV +WFqNrRa++k
  CA05g13390 22 KRRLKVDQVKALEKNFEVDNKLEPERKVKIAQELGLQPRQVAIWFQNRRARWK 74
                447899**********************************************9 PP

2HD-ZIP_I/II127.84.6e-4120112193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  e+krrl+ +qvk+LE++Fe ++kLeperKv++a+eLglqprqva+WFqnrRAR+ktkqlE+dy++Lk+++d+lk++ e+L++++e+L +e++e
   CA05g13390  20 ERKRRLKVDQVKALEKNFEVDNKLEPERKVKIAQELGLQPRQVAIWFQNRRARWKTKQLERDYNVLKANFDSLKHNYESLQHDNEALLKEISE 112
                  69*************************************************************************************999976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.861676IPR001356Homeobox domain
SuperFamilySSF466892.01E-181978IPR009057Homeodomain-like
SMARTSM003891.2E-171980IPR001356Homeobox domain
CDDcd000869.51E-172177No hitNo description
PfamPF000467.2E-162274IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.6E-192875IPR009057Homeodomain-like
PRINTSPR000311.6E-54756IPR000047Helix-turn-helix motif
PROSITE patternPS0002705174IPR017970Homeobox, conserved site
PRINTSPR000311.6E-55672IPR000047Helix-turn-helix motif
PfamPF021836.5E-1876117IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MLEGLDDETT CIEESGFGSE RKRRLKVDQV KALEKNFEVD NKLEPERKVK IAQELGLQPR  60
QVAIWFQNRR ARWKTKQLER DYNVLKANFD SLKHNYESLQ HDNEALLKEI SELKSKLHGG  120
NIETKLAVKE EAFEFEIDDK ELEQSNNPNN NNSNPELNFE NCFFNDGNGI ALESLSDSDS  180
SAILNDENSP NTTIISSSGA FVITSNVGSG SSSPNSNNSS LNCFQFLDSN LEHDVDVPMK  240
LVKLEEYNFF SVEESCSTLF TDEQAPTLHW YCPGDMSIEE EFSV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11924ERKRRL
26876RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016573188.10.0PREDICTED: homeobox-leucine zipper protein ATHB-6-like isoform X1
RefseqXP_016573190.10.0PREDICTED: homeobox-leucine zipper protein ATHB-16-like isoform X3
TrEMBLM1BEC01e-117M1BEC0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000432511e-116(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27182453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.14e-50homeobox protein 16